- FGFBP2 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-81341
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- HBP17RP, KSP37
- This antibody was developed against Recombinant Protein corresponding to amino acids: PVLRPSVCRE AGPQAHMQQV TSSLKGSPEP NQQPEAGTPS LRPKATVKLT EATQLGKDSM EELGKAKPTT R
- 0.1 ml (also 25ul)
- FGFBP2
- Rabbit
- Unconjugated
- Human
- PBS (pH 7.2) and 40% Glycerol
- fibroblast growth factor binding protein 2
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Angiogenesis
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
PVLRPSVCREAGPQAHMQQVTSSLKGSPEPNQQPEAGTPSLRPKATVKLTEATQLGKDSMEELGKAKPTTR
Specifications/Features
Available conjugates: Unconjugated